DPCstruct | MC8596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.91 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7Q1R2 | 5-76 | EVKDKNGEPIHEGDKVGTKFRGGRREGLVEKIVTSDSQDTSDLPIDVQNAPKVVFKDQHGHTVSHNPGTLTH |
| A0A6A4I691 | 44-112 | EVSDKQGNPIDVGDEVVTKMRGGKRQGVAEDIVMSEEEAKEKGVKHPPKVLFTDQHGHHVAHNPEALTN |
| A0A084RTE2 | 6-78 | None |
| I0Z1K4 | 15-75 | None |
| A0A0F0IF67 | 74-145 | None |
| A0A3N4IBD5 | 11-91 | None |
| A0A1L7XDT3 | 52-129 | None |
| A0A225A7S5 | 2-75 | None |
| G4TNM7 | 9-80 | None |
| A0A194W7P6 | 3-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.