DPCstruct | MC8594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 264 ± 40 aa |
| Standard deviation of domain lengths | 40.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3MBZ6 | 137-380 | RILRTLNSSQLDPTNYYDLQGLKRVKVQGEGTSSWLFNYVAARHGKVIPFPQETKGYFYYFQPPNLPEIAGEVRFRCMDSSDPAGFE… |
| A0A6A4I1G7 | 7-240 | RKRISTFDPSRLQKSDFLDISFYKRFTLRLQSASAASAPFKFHYTSSGYEKRNPFPIGSNGFFYYHLPKGLSPLAGDIRFRKTTISE… |
| A0A1C7MHX9 | 13-209 | None |
| B8PFV4 | 288-613 | None |
| A0A4Q2DS99 | 8-215 | None |
| W4KJZ2 | 191-425 | None |
| A0A4Q9P2F0 | 6-221 | None |
| A0A146IEQ5 | 422-717 | None |
| A0A4Q9MCL5 | 50-284 | None |
| A0A166L305 | 12-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.