DPCstruct | MC8593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 124 ± 11 aa |
| Standard deviation of domain lengths | 10.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3AVP9 | 28-142 | RAKAWEVHRWPLVKMVASKRTRIHLPASYMAKDGETTRIIYPGSDINQLVHIHYLESWDGGGVAANFVHADGIDSKRNEYLGPDPRV… |
| A0A6A4HZY5 | 10-147 | YDSETAPKEHVEYAKEKQSTMQDQASPLEGYPLQHAVAAGAGKLICPTSISHPERITEVPFARGDNLFWLTWRHYSQTILSDQQPGS… |
| A0A401H000 | 46-184 | None |
| A0A1C7LS57 | 64-180 | None |
| A0A0C3B4F3 | 65-172 | None |
| A0A0D7BHE6 | 1-119 | None |
| A0A4Q9ML26 | 52-170 | None |
| A0A4R0R960 | 45-160 | None |
| A0A1Y2F813 | 1-139 | None |
| A0A4T0K9V9 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.