DPCstruct | MC8592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 68 ± 10 aa |
| Standard deviation of domain lengths | 10.03 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 24.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2D3V0 | 4-64 | IFMPFINVKMAVGRTLEQKRELAEVLTREMVRILDVKPEWVELVIDEYPRKNWATAGQIHA |
| A0A143QCA2 | 1-56 | MIQITQTPGLTKERKRAVIEAVTRAYAEAAGKNPDKVWVTITEVPGENWGVGGVPL |
| A0A1I3UJ95 | 6-73 | None |
| A0A1M3PQ00 | 8-66 | None |
| A0A0D2DXQ2 | 15-87 | None |
| A0A2V2QDC4 | 1-62 | None |
| A0A3C1LA21 | 128-197 | None |
| A0A2G8TBU6 | 26-95 | None |
| A0A856LNC7 | 17-77 | None |
| A0A0R3QGP8 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.