DPCstruct | MC8591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 114 ± 9 aa |
| Standard deviation of domain lengths | 8.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X1ZSN0 | 4-113 | WKGVVIAEGLSDPTVINKLSVYKAEITRDGIPIDYEGNLGRWHIYYVRCAREEINALQPYILHGWYAHFWNEAKIIVVYDDKQFEFV… |
| A0A2N2D268 | 5-111 | NDYHGIIVNVSQSDKRIFPRLEILSSRTIIPGILILYKINIRPANLEETINHLQQNMRGKLFYAHLYRNDELIVIFKYRIFKASPDK… |
| A0A537G7C8 | 127-233 | None |
| A0A3D5Y782 | 265-381 | None |
| A0A2G9NQX4 | 17-131 | None |
| A0A0B3A6R8 | 1-122 | None |
| A0A7K0D4G0 | 19-141 | None |
| A0A0G1L3V7 | 6-131 | None |
| A0A1Q7ZSH2 | 1-100 | None |
| F7KE22 | 155-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.