DPCstruct | MC8590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 6.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 46.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9VK75 | 3-99 | RVNIQAPPNLSAPYYDELLDAGINDWGGVSPLTPDFINPEKPWPHLEQLRARTEAQGFKLEARLPVYPEFLSRALDRPGLLRERVQS… |
| K0B5W4 | 197-286 | SRIIMPKMNIQIPPNLSPRSYQSFLSVGINDWGGISPLTPDFVNPEFSWPEINRVEENSKQAGFDLKCRFPIYPEFFSFISKELQEK… |
| A0A7C0X205 | 65-165 | None |
| A0A1V5ZCC0 | 216-323 | None |
| A0A523ARY0 | 2-83 | None |
| A0A843DPA6 | 14-102 | None |
| A0A812AB96 | 19-106 | None |
| A0A066YRH7 | 288-384 | None |
| A0A383W8E6 | 64-165 | None |
| A0A5E4IKI4 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.