DPCstruct | MC859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 388 ± 26 aa |
| Standard deviation of domain lengths | 26.23 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G9VR78 | 3-352 | TAPYNFVPLNKEVFYPSWSEDVSHDIPFEDSESGEIDITITAKSPIFIRNHSDERDKPSEEFCQYNGEYYIPSTTVKGMVRSVLEII… |
| A0A176RVY1 | 1-404 | MSIYAPYNFVPLSAWLFKPDWATQVSHDLPFSDGICGSLELEIQAHTPILVGGKQQSATPQRPGEVHFFQLPDGSYAIPGTSIKGMI… |
| A0A836WER4 | 1-397 | None |
| A0A521LYC2 | 77-506 | None |
| A0A3D2VUB1 | 1-378 | None |
| W4M9F1 | 385-750 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.