DPCstruct | MC8589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 102 ± 14 aa |
| Standard deviation of domain lengths | 13.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9VHP2 | 25-114 | GLVERVDLDQPLAKGGRPLGYEPLGFEGTHFHSWLCHSMPKEASERLGLLPNRDGFIDTLDDAVRITEHMVATGAEPAIWEPWLVAR… |
| A0A1H7LIA6 | 117-210 | QTAIGLHQILSRRLLPSEGGVPLGSEVLGVELGGSLHSSLCNSLERAFAQHLGARPNGHGLLDDHALAQRCAVYAGSEAAQAEPIPW… |
| A0A1H0SNP2 | 71-188 | None |
| C2Z4S9 | 62-167 | None |
| A0A376DNN1 | 3-85 | None |
| A0A2A3HG06 | 2-99 | None |
| A0A2V9TMC8 | 38-146 | None |
| A0A6L9JA95 | 176-271 | None |
| A0A6C0FIQ4 | 76-185 | None |
| A0A1M7RBD3 | 124-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.