DPCstruct | MC8585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 140 ± 11 aa |
| Standard deviation of domain lengths | 10.82 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9NTV8 | 20-167 | SGTTLADGQLHFQTVRKEAIEIRLIALAIAYPRTSFFANDEVFIAEQELAKEESRFIKLVYDFLPYQSPLSTYGLNYSLVHRVNAIR… |
| A0A2V9V976 | 3-117 | GVAVASSKTSFFSNYEVFIAERRLSPGQTELIKLVFVFLPYQKRLSEYDLSTTKIYKLRATRDPRCDETLMQMSWPEGEQPDEDAAN… |
| A0A2V9TZ08 | 86-222 | None |
| A0A2V9TST7 | 622-764 | None |
| A0A2V8ZPR0 | 1-164 | None |
| A0A2V9ZWW4 | 631-770 | None |
| A0A2V9UKW7 | 3-134 | None |
| A0A1Q7CEW3 | 313-455 | None |
| A0A2V9YFQ6 | 469-609 | None |
| I3ZD37 | 18-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.