DPCstruct | MC8584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 83 ± 10 aa |
| Standard deviation of domain lengths | 9.67 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5SHU4 | 1-99 | MDPHIIVARAYEPFIDLLRANMQNCGALRIDHVMSLLRLWWIPYGETADQGAYVHYPVDDLLSILALESQRHRCMVIGEDLGTVPVE… |
| A0A2V9V132 | 1-88 | MGKPAEWWVQRLHWATQNCDYIRLDHFRGFEQFWEIAASESTAINGRWVDGPKDDIFQKLREVLGGLPFFAEDLGHITPEVHELRDRL |
| A0A0U5I732 | 5-80 | None |
| A0A060C6P8 | 1-86 | None |
| A0A821GE00 | 6-86 | None |
| A0A2X3GFR5 | 1-87 | None |
| A0A6V8MQ44 | 1-61 | None |
| J9FT22 | 1-83 | None |
| A0A6D0ELX0 | 7-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.