DPCstruct | MC8583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 9.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K8UD77 | 1-66 | MRVIYDAGPGNAAVARLECDGQPSVGLRWNGDEGRPLGNPQSRGNPTWFIVPAAFQDVVVERVRQL |
| A0A2V9UZS8 | 1-102 | MAYIEPATVLAPKASVRSVEILYSTRNGGWSVARVGWEGSDRVGIRWNGSEDGPGIGNPQSRGNATWFILPEELAQAVLNRLDEITM… |
| A0A368AC79 | 34-125 | None |
| A0A2N8I5T9 | 3-81 | None |
| A0A2S8ER84 | 1-92 | None |
| A0A085A5P5 | 2-90 | None |
| A0A4Q3KKR1 | 1-84 | None |
| A0A840XMC8 | 6-78 | None |
| A0A6G7ZBC0 | 1-82 | None |
| A0A2L1UZD1 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.