DPCstruct | MC8582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 315 ± 31 aa |
| Standard deviation of domain lengths | 31.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8UPJ3 | 146-460 | ANSDPNYRALRDNPPKETYAVSHLVLKRDAGSFILKSGHIIFVPAVLGRVTMAAFSGDGEFTLEPAVSTERGYLHMIADQDTVHESF… |
| A0A2V9UXV8 | 1-315 | MTLFAADIPAGRNSDPSYQQLRNLALGGETVGVSNLTIHRDAGTFHLRSGIVCFVVPVAGKVTGAVFVGDGNFVLDPALPSENASLK… |
| A0A2V9GZD0 | 12-331 | None |
| A0A7X6A5M0 | 100-426 | None |
| A0A7Y5VJL3 | 1-227 | None |
| A0A7V0UCQ4 | 5-315 | None |
| A0A3E0P482 | 41-398 | None |
| A0A2E6ENQ5 | 56-389 | None |
| B3QYL7 | 20-336 | None |
| A0A2V8NK27 | 50-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.