DPCstruct | MC858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 7.02 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5T540 | 4-93 | NFQITDANQVYDTLNLGRRIDVIWPDEGMRSRGGRNFWNNWVPVEGMEGIVIHTWKPHHPDPKLRSHVEKTIYLVQIQDKFVPVAKN… |
| A0A176RT09 | 130-217 | STPQKRAQIVDVGQIYEAINTTDCLTWPSSNIKEKGGKNAWGSFYPKKGDTGIVVSEVKHCHFDDNIYLLKIGQYYVPISSVGVQELP |
| A0A8B6D8W8 | 206-300 | None |
| A0A183HBE2 | 2-93 | None |
| A0A4W5MDA8 | 389-486 | None |
| A0A368FR93 | 344-443 | None |
| A0A3P6NR77 | 252-363 | None |
| A0A6J1WFX5 | 587-678 | None |
| A0A2H2JCE9 | 55-166 | None |
| A0A7J6B422 | 581-678 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.