DPCstruct | MC8578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 125 ± 22 aa |
| Standard deviation of domain lengths | 21.50 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.93 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF19533- PF13890 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8A795 | 136-271 | PMTEDMVDEYANYLSSLSDGEARVRAQLDVLYSDMQAFKAANPMCCLEDFIRWHSPKDWIEEEECLSERMQLPDNTWVKCWNDAMPI… |
| A0A843XQL5 | 12-121 | TGARLRRERLHVDAANPGCILEDFVTWYSPPDWKEENLDSKDDTSLKKGCLSGRMQTEGNLWRELWETAKPLPAAKQAPLFDEGLAV… |
| A0A7E4SGC5 | 79-230 | None |
| A0A2C9WG00 | 145-287 | None |
| T1P8T2 | 6-122 | None |
| A0A287HXK5 | 14-128 | None |
| A0A287HXG4 | 340-444 | None |
| A0A287HX72 | 1-143 | None |
| A0A287HX40 | 145-240 | None |
| A0A5B8MH94 | 418-531 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.