DPCstruct | MC8576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 63.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843XGU5 | 12-71 | KAEEGIEEKILGALRARVSDFKEQADSITLENVRRTLEKDLGMNAYALDAHKRFIKQSLE |
| A0A1R3GBR8 | 23-84 | AALEDDIESRITTAMRSRVSHFQEQANSLTFEGVRRLLEKDLGLETFALDVHKRFVKQCLLK |
| A0A5D2KF82 | 9-78 | None |
| A0A6N2M569 | 5-73 | None |
| A0A6L2N336 | 113-190 | None |
| A0A565CDG0 | 24-88 | None |
| A0A166BTQ0 | 1-61 | None |
| A0A2Z7B585 | 1-64 | None |
| A0A494G9R3 | 1-66 | None |
| A0A2P5Y6Y1 | 13-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.