DPCstruct | MC8575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 105 ± 16 aa |
| Standard deviation of domain lengths | 15.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G6RFW6 | 13-100 | AASRRAASAMVAAYGIAFQPSLTSRHIEGQAIDMSLHWTGDVTIKNKANKDVSIAGAPRDGFNPAKVGKSYGVVKHPSDPPHWSTDGR |
| A0A5B9E856 | 18-132 | NGPVDIDWAHRDTAGRSDLAAARAAAQQMVNGYGLQRLRVAPALHSRHIDGKAIDMNISWSGTLKIVDANGKTVAIDSQPRDGMNSD… |
| A0A3G3LJU4 | 14-82 | None |
| A0A521YSU9 | 16-116 | None |
| A0A1G6WQA3 | 403-498 | None |
| A0A7R8RD58 | 872-987 | None |
| A0A0T9Q6G6 | 1-81 | None |
| A0A7W6Q2C2 | 314-403 | None |
| A0A1H6ITH4 | 453-580 | None |
| A0A3A0A779 | 67-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.