DPCstruct | MC8571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 125 ± 16 aa |
| Standard deviation of domain lengths | 15.76 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1B347 | 477-589 | KPLYPGSGLCPGFTISRAILSDAVTLVRGDRFYTLDWTPATMTDWGFDIVKADKPQDKLARGGKMHHLLDVAFPKFYKDNSVWKMFP… |
| A0A814M937 | 30-136 | NSDGSGICANYTTSSAILSDAIAIVRGDRFHSKDATYYNLTKFGMEDSQSIDTIDFGTLIGRKLILRHLNSVYSQNNIYAIFPFTLP… |
| A0A0N1HTI0 | 543-679 | None |
| A0A2T3A6D6 | 346-463 | None |
| R8BPM7 | 312-443 | None |
| A0A194USR4 | 399-534 | None |
| K5WEP5 | 668-830 | None |
| A0A2V1CPY9 | 139-282 | None |
| A0A3M7DLS9 | 406-540 | None |
| F7W2H8 | 228-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.