DPCstruct | MC8570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5632 |
|---|---|
| Mean domain length (aa) | 138 ± 26 aa |
| Standard deviation of domain lengths | 25.85 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.14 |
| Pfam Score | 68.55 |
| Assigned Pfam label(s) | CL0144- CL0238- CL0304- CL0093- PF05582 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5MNQ6 | 2-137 | NPILVVDDVRYSLLILAKTLEKEGYAVETASDPAHALELLKKQDFSLVITDLNMPGMDGKEFFAAARNIRPTQEGQPFHCPPFILLS… |
| A0A379WNJ7 | 158-299 | YQEDRITIFYDTMSNNTRMMADAIAQGINEVDPNVAVKIFNVARSDKNEILTNVFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGLRF… |
| A0A2E0W003 | 285-405 | None |
| A0A1L9WJT5 | 552-680 | None |
| A0A3C1VER7 | 138-354 | None |
| A0A1M5P2A3 | 667-797 | None |
| A0A7Y4ZSX3 | 103-244 | None |
| A0A7Y4ZMN4 | 2-128 | None |
| A0A7Y4ZI24 | 2-112 | None |
| A0A7C5N0B8 | 122-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.