DPCstruct | MC857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 149 ± 13 aa |
| Standard deviation of domain lengths | 13.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 18.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H0GCN2 | 10-164 | ETLKNGNEKSFYLELDEEKNLNKFRFNLNEDAFIRIYPAVIPKIRTNKGTIKFVAYNITKKIQQTFTFTRQKTAYLSYPCHKILKYF… |
| A0A0A6P1T1 | 96-223 | LNNFFELEVDQFNGKLRIYSEPWFEYFEVSHTGPESVSIGAGVVKYLDHTEIVEFKKSQATVNYPIYSLQDIEWQYNNLGEVNWNKK… |
| A0A0F3GTE6 | 692-835 | None |
| A0A661EYZ4 | 331-480 | None |
| A0A125NZ34 | 1-163 | None |
| A0A497NY53 | 471-609 | None |
| A0A3N5P1L5 | 635-764 | None |
| A0A2P5N126 | 376-524 | None |
| A0A0A2HRN9 | 388-542 | None |
| A0A1W9L0Y4 | 879-1031 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.