DPCstruct | MC8569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 114 ± 11 aa |
| Standard deviation of domain lengths | 11.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5MLY4 | 60-158 | AKATPYSGVRWEDDRPIVCVHNRWSALVSIDGVTVEHILDFARNEFGDLAHKRFAEDLVEVLSKMGHDPDWEVTLGLESKEGQVEEL… |
| A0A517TQC2 | 245-352 | VDYPKRSPFDAVRWHENQPEVRLNDEWFRLVSIDGVTADEIVEYCDWTYFQKSRKRFEEDLVEVLTHMGHEPDEAVTLVVSPLDGDE… |
| A0A2E3XXH0 | 5-132 | None |
| A0A518K356 | 250-358 | None |
| A0A5C6AXY9 | 739-839 | None |
| A0A3E0NLV9 | 17-136 | None |
| A0A2E8JGW5 | 33-175 | None |
| F2AXW7 | 19-129 | None |
| A0A812JPU7 | 408-515 | None |
| A0A5B9VZL0 | 8-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.