DPCstruct | MC8564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 118 |
|---|---|
| Mean domain length (aa) | 315 ± 88 aa |
| Standard deviation of domain lengths | 87.65 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01937 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183VYN5 | 4-177 | WLVDDYDKWINRISVPGSPYRCILIFCDNSGADIILGVIPFCMEFLSRGCKVILAANSSPAINDITYQELELLLHMIAGFDPLIADS… |
| A0A7V4QEU4 | 278-673 | QCFIGEKEKQRLASNWNEKEFLEALDAHKFDSEIKRFIEEHYPYIRRIVWSAFNFRPHFTHGQPLIDTLPISLAEDIVRKIISLYFK… |
| A0A1E7HWU4 | 96-434 | None |
| K8F731 | 656-1053 | None |
| A0A7S4E5W3 | 290-701 | None |
| Q9X838 | 272-666 | None |
| A0A6I9YDC3 | 337-499 | None |
| J5T3C2 | 5-239 | None |
| A0A0G4H227 | 44-494 | None |
| A0A443NVX6 | 14-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.