DPCstruct | MC8563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 4.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167BMQ8 | 1-71 | MKQLEILDEEHMSWLLFRCGDEHFISVIAGTVGVFTLEVKLSNTEASIYARNGKKYIDELADSIRYNPKHF |
| A0A318J956 | 22-93 | VIAAEPWSWMLFSDGTGFIVVVTCGSVGLFDVSIRLTPDEASSYAIEEREFISRFASEVARNPSAFDNRCIR |
| A0A846V4F6 | 149-221 | None |
| A0A3T0VLT0 | 1-68 | None |
| A0A4Q5VED3 | 2-64 | None |
| A0A1K2IS57 | 30-108 | None |
| A0A5C7WQJ0 | 9-83 | None |
| A0A0F4QU31 | 2-69 | None |
| I4B7I9 | 16-77 | None |
| A0A7Y2FJB8 | 174-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.