DPCstruct | MC8562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0279 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C6Y4B8 | 29-112 | LQAVIRKKLLDSMKSRQKDVASTLKVFLSEIEYANKSSKPVTTDLDVLRVLKKNIKKRKQAIEQFRKAERLDLAEKEESQIQTL |
| B1BDN0 | 1-88 | MSLKEKIQQDWKGAMKSRDKFRSSTLSMAKAAILQVEKTDNRVLDDEEIIGILSKEVKSRRDALVDFEKGNRQDLVEEAKSEIEILLE |
| A0A0G1RP86 | 20-105 | None |
| A0A1C6RVH5 | 1-92 | None |
| A0A7T9HZ13 | 1-92 | None |
| A0A1V3X133 | 1-89 | None |
| A0A2H3HP01 | 14-138 | None |
| A0A1I7Y6U0 | 274-363 | None |
| E0U5Z0 | 171-263 | None |
| A0A520VXG5 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.