DPCstruct | MC8561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 69 ± 2 aa |
| Standard deviation of domain lengths | 1.54 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 94.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05683 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3XV54 | 6-74 | KGSAIYYTGPSPAPYGKVIGSCGPTTSSRMDPFTPLLLKYGLKVMIGKGERSEEVMNAIRKNNAVYFTT |
| A0A2V3JJF9 | 355-423 | RGQLIYYVGPSPAPPGRPVGSAGPTTSYRMDAYTPRMLAEGVLATMGKGRRSPEVKAALKEYGAVYFAT |
| B0EPH7 | 391-456 | None |
| A0A7V3M2Q8 | 3-73 | None |
| A0A5E6NV32 | 135-204 | None |
| A0A2V6XMC3 | 63-131 | None |
| H1D992 | 1-70 | None |
| A0A7C6PL02 | 115-183 | None |
| A0A1E3X3L9 | 57-125 | None |
| A0A4P0Y5H1 | 203-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.