DPCstruct | MC8560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 152 |
|---|---|
| Mean domain length (aa) | 124 ± 25 aa |
| Standard deviation of domain lengths | 24.76 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.30 |
| Pfam Score | 90.48 |
| Assigned Pfam label(s) | CL0023- CL0141 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A654ILK4 | 2-110 | ILYFKDQNVDIVVCEAGIGGVKDTTSFLTNQLFSLCTSISFDHMDLLGNSIDEIIYNKINIAKPNTKLFISYDNLKYKDKINEQLIN… |
| A0A2X3ISF3 | 22-178 | SFAEIEAARGDISLTYFEYGTLSALWLFKQAQLDVVILEVGLGGRLDATNIVDADVAVVTSIALDHTDWLGPDRESIGREKAGIFRA… |
| A0A287Q3I6 | 78-185 | None |
| A0A1V6SZ18 | 640-778 | None |
| A0A847JIW4 | 3-132 | None |
| A0A535VTV3 | 436-596 | None |
| A0A3Q0J9E0 | 305-413 | None |
| A0A806KCM1 | 2-85 | None |
| H0ETY6 | 54-162 | None |
| A0A0P7GZA9 | 122-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.