DPCstruct | MC856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 206 ± 16 aa |
| Standard deviation of domain lengths | 16.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3AC22 | 38-246 | DIKSLALKRMSAVNSPDLHLINIPQSWQDTIAEGLAAIMNAHSLPESDTVFNIYCVHDLTTPFQIYNDLLIQVDVSYPWTVAWQNLN… |
| A0A0A6NZ23 | 37-244 | STKKYLKSKYTRLELDAIALSQGSSKDGFVNERLIVKIVKALKTIQSEYPEVGQIHSDGQHALNSLIIGLTKDAKKIFERKAEIVEK… |
| A0A2E4X3G9 | 150-338 | None |
| A0A1Q3GQE4 | 36-231 | None |
| A0A2E6ENJ6 | 99-314 | None |
| A0A6N8V2C4 | 30-252 | None |
| A0A150NZN5 | 154-356 | None |
| A0A6L7RZN1 | 8-173 | None |
| A0A0K1Q217 | 45-276 | None |
| A0A7W9SRR1 | 10-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.