DPCstruct | MC8559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 447 ± 37 aa |
| Standard deviation of domain lengths | 36.99 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A654IDU6 | 1-419 | MLGSIWHKTINGVNDKCKISYLNKNEVIEFLSTQEPKNILCLGSRYGSINYVLNQLEQKYPDKFNKKTVYASIKDDEQITEPKTTSA… |
| A0A0M9ELR2 | 143-606 | SKPGPKPIVIRCHCWDGNALAKQLSALIKRYGAKNTAIIAPVVRKRGPLQNVVNLLSEQYDVPIYVSIEEEVALDDRVIEGKMCVST… |
| A0A0N1H2T7 | 751-1237 | None |
| A0A428TQM9 | 293-772 | None |
| A0A194VD85 | 1-493 | None |
| A0A6C0CG19 | 213-653 | None |
| A0A316P3M5 | 198-598 | None |
| A0A4P7AJL0 | 41-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.