DPCstruct | MC8557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 189 ± 29 aa |
| Standard deviation of domain lengths | 29.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I0Q1A9 | 3-183 | TRFHKLFWIWQLQKEEAWINEMASHGYGLISVGRITFDFEDIEPDRYGYKVVFRKGASNSDSVRNFLKFMEELGIDNVGHVSFPNYT… |
| A0A1G4VTK9 | 1-191 | MKKIRYFAGMLNTQEEWLNDMAAQGYRLKKVHKLVYEFEECEPGKYQYAVEYVGNKDYEELKKYHDFLEDVGYTVFYKNINLNYSVG… |
| A0A343JDW1 | 5-223 | None |
| A0A7X2T3S7 | 4-196 | None |
| A0A1D3TXC0 | 7-223 | None |
| A0A847D1V0 | 2-152 | None |
| A0A0Z8J6C5 | 2-140 | None |
| A0A072NF84 | 5-173 | None |
| A0A1Y4WFJ2 | 1-199 | None |
| A0A1Q9YAT1 | 333-524 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.