DPCstruct | MC855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 7.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7BUW2 | 176-267 | EFNKGKQEGIKLGIQQCLDDPNSCGINMPDAIVSENTLKNDCIASYSLNGQLHIPCVSVPDVFGGITIYDIKMNQQTGAFIFDLDMD… |
| A0A0A6NX70 | 1-86 | MNGGDYDAGYQAGIEQAQQECQNDPASCGIDSASCKHSTYEPSKGEVHIPFIDVPGDFGTTQTFDIYLMQQPSTLTFDLDLQRIIL |
| A7BUK7 | 234-331 | None |
| A0A090AL54 | 350-428 | None |
| A0A3C0I5D0 | 241-341 | None |
| A0A496VMF0 | 308-390 | None |
| A0A496UZZ2 | 255-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.