DPCstruct | MC8549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 343 |
|---|---|
| Mean domain length (aa) | 120 ± 23 aa |
| Standard deviation of domain lengths | 23.25 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.68 |
| Pfam Score | 98.88 |
| Assigned Pfam label(s) | CL0125- PF16211- CL0012- CL0020- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q22979 | 1-65 | MSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKNAVSEGTNAVTKYTS |
| A0A2A2J8Q4 | 59-186 | MESSSGVDIRYQFSKMDEDNEVGLPQKGLNMIMKDAIPEMRIANESREIFNNCCVEFIKYISREAQQISGNDQRKTIYHEHVQKALQ… |
| S7RJI5 | 91-229 | None |
| A0A5D3CS91 | 1-117 | None |
| A0A1I8IDS8 | 458-563 | None |
| F6QT13 | 1-65 | None |
| Q2HW83 | 21-101 | None |
| A0A0D3GZR7 | 3-159 | None |
| A0A4S4D4U6 | 280-398 | None |
| A0A194VTP1 | 2-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.