DPCstruct | MC8548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 195 ± 32 aa |
| Standard deviation of domain lengths | 32.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4VD00 | 1-155 | MEISREKLNEKLASFDKLVEVEINLITSGEKVTKPTQQTPEYLSLRQELEKVVEDISKTGEPSPYDWKCLRSFIIVMARDVLNQMYS… |
| A0A2A2J1Q8 | 9-191 | KHPNPQIEEYFEFVAQVGIPCVSWDKIKPAFLWKIKFVMDEVVRVEKLKSGTQSTSADDNSSFDETYKAILDKAADFDGAPFTWQRI… |
| A0A0B1TUE7 | 868-1082 | None |
| C1E531 | 2-226 | None |
| A0A2K1IU53 | 28-225 | None |
| A0A146H7Y6 | 2-245 | None |
| A0A672QA30 | 15-203 | None |
| A0A164WTP4 | 28-230 | None |
| A0A1D2N4F6 | 1-201 | None |
| A0A2J8ACC3 | 8-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.