DPCstruct | MC8545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 80 ± 12 aa |
| Standard deviation of domain lengths | 12.31 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 94.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4IYA5 | 1-71 | RGHLRQFMSTVTGSEVCGPEFTPDNSTLFLAIQHPGEGGTYEKPISRWPDDVTPPRPTVIAIRKQSGGAVG |
| A0A7C8XKD4 | 59-130 | DPASGEIRRFMVGPVGCEVTGVSFAPDQRTLFIGIQHPGENGGSTFPEHLPNGKPRSSVIAISREDGGVIGA |
| W9VGL0 | 161-241 | None |
| A0A7C4IC42 | 57-145 | None |
| A0A6F8YKC1 | 1-63 | None |
| A0A7W1FLT8 | 111-208 | None |
| A0A2S5NP33 | 153-249 | None |
| A0A6J6KVU6 | 162-244 | None |
| A0A6G3LIE7 | 49-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.