DPCstruct | MC8544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 246 ± 40 aa |
| Standard deviation of domain lengths | 39.80 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3YH91 | 199-438 | ESLEFWEKQIWEMNKAYQVWQIIREKKLEFLRKITLTSKGPEGPKVTFLLANLPQEVVSSFKNASEFCETLKNPQFLRSYLPEGVPL… |
| A0A7V4EKB4 | 24-234 | LYRVFSRIQTPEDCLNFASRYGMLRSKIYAEQVSRWQAEAKLIREALTAYRILETGDFEALEEVVTDRPAVQAQPGAVDWYTVDFEK… |
| A0A356UB80 | 26-265 | None |
| A0A2P8H4V2 | 100-314 | None |
| A0A1Y5E523 | 5-230 | None |
| K6Q0S7 | 13-237 | None |
| A0A7X3QJZ4 | 2-212 | None |
| A0A1V4VLT9 | 22-301 | None |
| A0A523K4X2 | 8-158 | None |
| A0A1Y4GDJ5 | 12-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.