DPCstruct | MC8543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 100 ± 16 aa |
| Standard deviation of domain lengths | 16.49 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14714 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4AUS4 | 203-300 | IDCAMVAYDNYNRRIPTGELNRLLREWVDSRPLTRKGRDLKVYYATMSRVRPPTVTIFVNDPALMHFSYERYLVNQLRRQFGFAGTP… |
| A0A7X6P142 | 4-80 | VPTRKVNDVIRRAQQAQPGPHGVRVLYATQGAIDPPTFTLFANKAIPPHYVRYLERMLREEFDLGATPIKMRIRKRT |
| A0A7X4AGQ0 | 13-101 | None |
| A0A846NVG9 | 2-90 | None |
| A0A2V7IPS7 | 743-843 | None |
| A0A5J4YIU1 | 628-732 | None |
| A0A838RGA2 | 2-89 | None |
| A0A3M0Y3F8 | 4-96 | None |
| A0A845WMY0 | 8-105 | None |
| A0A816JS01 | 907-1017 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.