DPCstruct | MC8542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 305 ± 48 aa |
| Standard deviation of domain lengths | 48.45 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A399Z4P8 | 10-246 | VEVDDFPVKVDGFRYTPQTYLDVLRGASQPRQPQDADYAAILARFNLLPKIAGGEIDEVWLFAFPNAGLYESVMGGAGAFWCNAPPL… |
| A0A7V3UYB5 | 2-272 | TQEVIQALQEGSRFRGYKNPSAKPALLYKIVASFEFLKPLPTRPLQAGEAAPWTDYNAIMAQIGIRDLVERRGVKQVWIWGYHGGKV… |
| A0A0G2ZIT7 | 646-1046 | None |
| A0A7T9DDQ5 | 279-563 | None |
| A0A7V1WAE3 | 25-342 | None |
| A0A351LAL7 | 679-989 | None |
| A0A7C4C851 | 26-330 | None |
| A0A1Y6EP67 | 143-480 | None |
| A0A7Y5PW27 | 373-703 | None |
| A0A1F7GDM1 | 584-906 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.