DPCstruct | MC854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D2WZ00 | 4-68 | KHYWNYRVILKDDCYQICEVYYESGEPLWITQESVCPLGETLEELKEDIENYIKALDKPVLKYKD |
| A0A5C7LQG0 | 12-82 | YWNHRVIQYPNGHFGIHEAHYEKSSTPNLITLDAVSIYGESLEEVKQTLERMLRALEKSPLKYRKYVKKKD |
| A0A0G3BCJ7 | 2-67 | None |
| A0A1H9PJM0 | 1-79 | None |
| A0A6P0VBZ6 | 2-79 | None |
| A0A6G6WYM6 | 14-92 | None |
| A0A0S6VSP4 | 1-82 | None |
| A0A1B9JVH2 | 3-69 | None |
| A0A4V1EH55 | 79-149 | None |
| A0A1F7X4E7 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.