DPCstruct | MC8538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 464 |
|---|---|
| Mean domain length (aa) | 155 ± 24 aa |
| Standard deviation of domain lengths | 23.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.66 |
| Pfam Score | 81.80 |
| Assigned Pfam label(s) | PF05033- CL0489- CL0652- CL0010- PF11907 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847MBE6 | 5-148 | GEIPGIKVGQLFANRRELHDSGVHRPLQAGICGSADRGAESVVLSGGYEDDEDLGDEIIYTGHGGQDRSGVQIADQKLVNQNAALAQ… |
| A0A7X7WAE7 | 5-132 | RAEIYKRSLIHEEYGGNRQSGISYPAKHYMVFIFTGFSGEEYGYNDRWENGYFLYYGEGQEGDMEFVRGNKAIRTHREKGKSLHLFQ… |
| A0A7X7BRR1 | 23-187 | None |
| A0A1Y2HUK3 | 348-542 | None |
| A0A4S2MIX3 | 120-284 | None |
| A0A1C3F949 | 60-206 | None |
| A0A803PYI2 | 7-157 | None |
| A0A7J8IDA2 | 416-606 | None |
| A0A6P5FLW4 | 50-219 | None |
| A0A7N0UD35 | 236-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.