DPCstruct | MC8534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 580 |
|---|---|
| Mean domain length (aa) | 166 ± 29 aa |
| Standard deviation of domain lengths | 29.48 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 12.74 |
| Pfam Score | 73.88 |
| Assigned Pfam label(s) | CL0023- PF09536- CL0210- CL0161- PF12625 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6YFZ1 | 6-164 | ELSHAFVVARFYEELKSAFGNRGTEAFAHMTTVYARQRGSRMAQRAIRDGKPLDFTSYRIYGEWQKTEAAERVTGGFAGRTVSIAPD… |
| A0A1F9CNN5 | 9-155 | YLEEGILAFAWYPEEDVLAILRALAKVSPDPGMDIYEFMGRTLARTNLGGVYAHLLRPGDPGGSLRLTSIIWGLYHDTGREVVVESG… |
| A0A1B2A221 | 11-150 | None |
| A0A662TUE8 | 14-159 | None |
| U1PRQ2 | 5-162 | None |
| A0A1A8ZMR3 | 13-186 | None |
| A0A7S2RK51 | 13-141 | None |
| A0A523ASX4 | 113-269 | None |
| A0A7W0VBE2 | 748-934 | None |
| A0A7C5UP10 | 256-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.