DPCstruct | MC8530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 298 ± 53 aa |
| Standard deviation of domain lengths | 53.04 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J6UGD9 | 4-284 | TQAAYYKIGTDPAYKPEYSLFFDAGCGFTLQLYHVKGVVGAVAGVVPKNPVPSSAGQPVTATRIKAGEQIGWFQGEAGKSVAFDLRM… |
| A0A497J578 | 59-370 | ENMKFIFPVNLSDIDFEGGGFSAFGIHAGDHPEGLDHIWVYCKSSDNPVLATANGTVYMVNKREDYSILLKHGERFMTEYGHLRSVL… |
| A0A2D6SPU3 | 202-536 | None |
| A0A5N8YVH8 | 263-601 | None |
| A0A2E7XA59 | 438-800 | None |
| A0A2E8S0Q8 | 416-728 | None |
| A0A2E5JVE4 | 35-323 | None |
| A0A2N0MLI9 | 1-223 | None |
| A0A7T5UJN6 | 31-371 | None |
| A0A382WHK4 | 7-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.