DPCstruct | MC853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 9.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A382QS07 | 1-90 | MTKTLTEDQMDDLYNAAHTVDGEIVTDYSGRGMFGAECVGIILNDDCALFTFARLLDDDLAELLGNPRWDNMGLREIAYWPNVAHQS… |
| A0A5C7LMX0 | 1-102 | MSQISLLQEILTIFAQDHPTAELRSYSGRGMNGKQCLAVVIRSWDLGLLVGELIAYAVAEAEHVDPRRLNELYKQVKSLQADSMGHG… |
| A0A1X1YBS8 | 3-102 | None |
| A0A511MBX4 | 17-116 | None |
| A0A497APC3 | 8-126 | None |
| A0A842RW60 | 1-82 | None |
| A0A6I3SAN2 | 1-100 | None |
| A0A1V5I9M1 | 2-91 | None |
| A0A2D0L9A5 | 36-124 | None |
| A0A2D2LXK5 | 14-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.