DPCstruct | MC8527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 96 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.52 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0063- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0RUM1 | 358-453 | KPLALGSIKPAGWLRNELQLMSDGLAGHEHDFYDYVAHSLWLGGDKEYSGLNEGFPYWFNGIVPLAYGLDDERLMAQVRSSVQTVFE… |
| A0A179T028 | 1-104 | MIGENLSELSLKPFTTNEIKPIGWLLRQLQIQAEGLSGNLDKFWPDIKESKWVGGDKEGWERVPYWLDGFIPLANGVGDQTLAFIFP… |
| A0A3D2WW81 | 37-131 | None |
| A0A5N6FST0 | 1-99 | None |
| A0A2V5I6X6 | 1-90 | None |
| A0A0M2PFM8 | 1-95 | None |
| A0A373IMQ4 | 24-100 | None |
| A0A560J7L8 | 18-145 | None |
| A0A7V4M312 | 44-149 | None |
| I8A9V8 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.