DPCstruct | MC8522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 9.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S5JIB5 | 193-260 | DKKAKDPSRIIAQWQDQNGECRGGAGNSDETLRACDRREAIGAKLEAVGWCYGREGEYGYQMAWHVCG |
| A0A515LBK4 | 63-152 | IRLHETAPSVSAESEAAAKPADAFSSEEKKLIETWQDLNGRCRGGSGDDPQTMTACDERDGPVAAQLADANICYGREGEYGYQMELH… |
| A0A7R6YR98 | 1-78 | None |
| H1ZX44 | 13-109 | None |
| A0A6J4ZKC9 | 267-336 | None |
| Q9RWC8 | 48-141 | None |
| A0A1B2A952 | 136-208 | None |
| A0A2A3MWA8 | 79-163 | None |
| A0A0N0MDC1 | 262-342 | None |
| A0A7V9MZI9 | 3-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.