DPCstruct | MC8520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 287 ± 48 aa |
| Standard deviation of domain lengths | 48.04 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1R211 | 1-214 | MIPDGALVLFKSKPAITRRDGDRIELTFGNGGTARVRDKDVELVHEGPLKSIPAIASGGEFETAWEMTAGSEIGLGELAELAFGTSG… |
| F2D9B4 | 46-316 | ACRGRLVDSVLQELRSRRRVRVSARIGLQGTKELSDSKIEKKPIQKGLLLEFHKDSERSLLAVVERPDGKKNWVVTDQNGILSSIKP… |
| A7BS42 | 4-278 | None |
| A0A6S7ATM8 | 2-225 | None |
| A0A7S0BEG0 | 1-334 | None |
| A0A498IGY9 | 453-776 | None |
| A0A2T0FI67 | 44-359 | None |
| A0A5S9EZ71 | 2-252 | None |
| A0A830DCP7 | 73-394 | None |
| A0A287EM27 | 1-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.