DPCstruct | MC852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 100 ± 8 aa |
| Standard deviation of domain lengths | 8.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R0XFK8 | 1-89 | MLDDDGYPTEEALKRIEEWPHTDWTGLLAFTQPLWSYPDRWWTEGDVLNLSTGGWSGNEDIIRAMQGNRTFWAICWISSRRGGWCEF… |
| A0A5C7LJX9 | 2-108 | TVEPREMSYTNDGYPTVEGIAAVQNFSGTPHGFVELLREVWSHEDLVSVHDTDGGVMEIRCVTVGWSGNEELISAIEESMFGLRFWE… |
| A0A1A2QB57 | 7-107 | None |
| A0A100WCI8 | 22-127 | None |
| A0A0F9S4M2 | 1-89 | None |
| A0A1G0B2Z6 | 65-157 | None |
| A0A2W1U266 | 236-349 | None |
| A0A401XIV0 | 28-141 | None |
| A0A497ARV7 | 11-115 | None |
| A0A1G8BYX4 | 93-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.