DPCstruct | MC8519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 51 ± 4 aa |
| Standard deviation of domain lengths | 4.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 69.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402G1L9 | 6-61 | KKVLHMDRNAYYGGESASITPLEDLYKRFNLPGSPPESMGRGRDWNVDLIPKFLMA |
| A0A822BWT0 | 1-50 | MDRNKYYGGESASMTPLEELYSKFNFPSPPSDTGRGRDWNVDLIPKFLMA |
| A0A287FZ44 | 1-61 | None |
| A0A565C558 | 1-46 | None |
| A0A2T7CQC6 | 1-49 | None |
| A0A822XTX6 | 85-133 | None |
| A0A5N6NZ63 | 29-78 | None |
| A0A4S4DDJ9 | 29-78 | None |
| A0A4P1QRU1 | 97-148 | None |
| A0A287JAD7 | 1-46 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.