DPCstruct | MC8518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1307 |
|---|---|
| Mean domain length (aa) | 320 ± 71 aa |
| Standard deviation of domain lengths | 70.70 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.88 |
| Pfam Score | 97.98 |
| Assigned Pfam label(s) | CL0010- CL0111- CL0052- PF16602- PF15509 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0LG97 | 5-234 | NGKFGIINFSNNCYLNVIIQLFLYNKNSSNIIMNYLDILNNNGANIINPEKLMIKLSEKINVSRQNDSQEVFTLILDLIPDLEKYYV… |
| A0A6G1QLZ6 | 38-411 | GASRMEILMTVSKFASFCTMGANASALEKEIGSEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKILAYRSQPRRKENLLTC… |
| A0A2G8LEY8 | 206-664 | None |
| A0A2G8LBY2 | 119-293 | None |
| A0A6P8HLE4 | 67-383 | None |
| A0A6P8HAB7 | 256-567 | None |
| M2Q5B4 | 407-751 | None |
| A0A497P4P9 | 166-466 | None |
| A0A4Z2I0S6 | 14-363 | None |
| A0A4Z2HPR5 | 14-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.