DPCstruct | MC8517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 309 ± 19 aa |
| Standard deviation of domain lengths | 18.57 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.75 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0229- CL0422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8FQX9 | 1-315 | MTVFASCFCRVKCTYCDKEFTEDDTAKVECGHMFHLSCLRDHSDTNCRKCKKKISTDYKPCGVVDKETFLKVNRFRRKCNSFFVEFM… |
| A0A060XKR1 | 70-385 | NSDVKSEEPFAAIITILKTCKQKASDLICKFGFQCRVCMGEPQDPVDLPCHHIFCLTCVRGCLNTGQMYCPMCKHELPDDFQVKVSE… |
| A0A8B6HEH1 | 301-624 | None |
| A0A6P8G2B2 | 95-355 | None |
| A0A8B6DAW4 | 307-614 | None |
| A0A1X7SQJ3 | 1-323 | None |
| A0A4Z2CGM4 | 406-703 | None |
| A0A1U8E0D7 | 761-1080 | None |
| A0A1S3QUZ3 | 167-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.