DPCstruct | MC8516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 172 ± 17 aa |
| Standard deviation of domain lengths | 17.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8HJG4 | 269-413 | FIYQIVTTLIPYRVKGFRNNQEVSVLFDYAEFFLTHLNQGWKLVGIIQYDTGKNRLNSFWFFEKEKTRIDDSSPVYEGTIVAHKHIY… |
| A0A8B6G4Y2 | 60-260 | FFEIPQHPSPELYQYQAVPLKLTAQLNVSMGFGTPNQNWGLQLDWQGVMNQYLGTGWRLIEVFNDMSADTSSGMTGFGSSSTTSVLN… |
| A0A668AIW0 | 3-168 | None |
| A0A1S3IZ53 | 207-364 | None |
| A0A226P4L1 | 320-480 | None |
| A0A1A8LBW0 | 223-385 | None |
| F1N1Q3 | 187-384 | None |
| S9YL77 | 107-290 | None |
| A0A6P9AM91 | 226-436 | None |
| A0A5C6PM15 | 5-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.