DPCstruct | MC8515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 303 ± 43 aa |
| Standard deviation of domain lengths | 42.90 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.12 |
| Pfam Score | 91.11 |
| Assigned Pfam label(s) | CL0020- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6G4V2 | 3-335 | RYPEVKPTNCVPHEAVKPMKNSVAPRLGQSRCEIVEMLYKDLGIKTNSGLNIDNMMQFCVAALSHHAGEVRDGSERIIKALYKEDRQ… |
| A0A1B0D0L6 | 318-598 | ASCTEVRQQNLVAPALSRPVGSGTHPRLALSRIQMLEQLVLSQGISTDKQSGLTCRSLTECGCSGIHHPSEPVRKVAERVLLLVYRI… |
| A0A0M4E377 | 409-690 | None |
| F1L8Y3 | 40-345 | None |
| A0A812GX20 | 918-1168 | None |
| A0A2P6N6I5 | 189-510 | None |
| A0A3F2RUV0 | 153-369 | None |
| A0A7R9FVQ2 | 470-862 | None |
| A0A7R9A2H2 | 658-975 | None |
| A0A2G8LKK9 | 7-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.