DPCstruct | MC8513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 265 ± 13 aa |
| Standard deviation of domain lengths | 12.80 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 71.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4UQB1 | 243-490 | MGEALPYLFKRLPLWTTEANDLDYKCTYPFTACLEKEFMSWNIGKKLAAEWSRAKAIKRIVASEPYSEHWTTKAIFMYGRSHAYSPA… |
| A0A8B6G336 | 1-289 | KYQHPYCASTSEEWLSWKVGKRRASEWQRAAFCRNFILNHIKGETYKGTKLWTTKQIMLWCRLHAFSPHYLESTLHPFGVELTADRI… |
| A0A6J1NVN8 | 530-797 | None |
| A0A4Z2BZZ0 | 105-357 | None |
| A0A6L5D000 | 607-864 | None |
| A0A2G8JZ94 | 25-298 | None |
| A0A811W362 | 432-686 | None |
| A0A1A6G1V6 | 327-599 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.